PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016490765.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 790aa    MW: 88885 Da    PI: 9.8134
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016490765.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B346.56.8e-15229321498
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                      + ps+v++   l++  +fa ++ +++ ++  l++  +   sW+vk+  + ++      +GWk Fv +n+Lk gD++vF++++ ++    v++fr
  XP_016490765.1 229 FMQPSYVFSPFHLSIALNFAGKYFLENYGNLVLRVPGRGRGSWSVKC--TTGGTNAKVHSGWKAFVLDNKLKCGDVCVFEVIKGTRLFIDVTIFR 321
                     6789*******************88888887888888888*******..8888888899*********************987655556677766 PP

2B342.71e-13494584599
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                     + ps+v++  rl ++  fa+++ +++ ++  l+l+ +   sW vk+    ++ ++ ++  Wk Fv +n+Lk gD++vF+l++ ++  l v++fr+
  XP_016490765.1 494 MQPSYVSTPYRLHISFLFARKYFLEE-CG-NLVLRVPGRGSWPVKYALGISKTQICFS--WKAFVLDNKLKFGDVCVFELIKGTKPILDVTIFRA 584
                     6799******************9884.44.8***************999999999998..*********************88777788888885 PP

3B351.22.2e-16695781794
                     .-HHHHT...T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
              B3   7 psdvlks...grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                     ps+v++     +l++  + a+++     ++ +++l+ +s +sW vk+i   +     lt+GWkeFv +n+Lk+gD++vF++++rs+  ++v
  XP_016490765.1 695 PSYVSSAsgpMQLSITLSRARKFFAT--RHSDVVLKVSSKKSWAVKCIL--GTANAKLTSGWKEFVLDNNLKVGDVCVFERVSRSKLLFNV 781
                     44444445567899999999999755..4558***************65..333346***********************88776664444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086310.941165IPR003340B3 DNA binding domain
SuperFamilySSF1019368.63E-11565IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.2E-11577IPR015300DNA-binding pseudobarrel domain
CDDcd100171.21E-6563No hitNo description
Gene3DG3DSA:2.40.330.103.0E-19218323IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.89E-18219322IPR015300DNA-binding pseudobarrel domain
CDDcd100176.86E-15224321No hitNo description
PROSITE profilePS5086311.265226323IPR003340B3 DNA binding domain
SMARTSM010193.3E-9226323IPR003340B3 DNA binding domain
PfamPF023625.4E-12228321IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.5E-18483584IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.22E-18484584IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.265490585IPR003340B3 DNA binding domain
SMARTSM010192.6E-12493585IPR003340B3 DNA binding domain
CDDcd100175.05E-17494583No hitNo description
PfamPF023629.5E-11494584IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.6E-22681785IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.24E-20682785IPR015300DNA-binding pseudobarrel domain
CDDcd100174.42E-15687784No hitNo description
PROSITE profilePS5086312.774692787IPR003340B3 DNA binding domain
SMARTSM010192.7E-9692787IPR003340B3 DNA binding domain
PfamPF023621.9E-14700783IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 790 aa     Download sequence    Send to blast
MLNPVYLEVP SGEVWEVEVV HSQGQICLGI GWQDFSDFYS ISCGHFLIFG YNARSHFNVT  60
IFDLSASEIE YPYSSAHNIH TPISHCHETR CAPKRDQSES DDTVEILEDI PRSQKAKAII  120
PDTVEHSVEN LRHCPLEQSS KRKRQERNAE DVVSVDMHVK RMKVEKLQED VASPSFIREG  180
QKSNKGCRMH KQQSDSVYGQ NKTVMDKERA VAYQRAKAFK SKNPFIISFM QPSYVFSPFH  240
LSIALNFAGK YFLENYGNLV LRVPGRGRGS WSVKCTTGGT NAKVHSGWKA FVLDNKLKCG  300
DVCVFEVIKG TRLFIDVTIF RAAGSTLMHK IVGEVPGGSD SKSKVIKTDS SVPCSQRKVV  360
HTKKLKQRTG GSNGFYSKIK EHGEGTEIEH SVEICGHCPL GQGSKRKRSE GETKDDVSID  420
IHTKSIKVEN TQEDVASPSF TRKTKKSGES CRMDKQQSKM VYDKNKTVLD KERTVPYQRA  480
KTFKCENPYV MYFMQPSYVS TPYRLHISFL FARKYFLEEC GNLVLRVPGR GSWPVKYALG  540
ISKTQICFSW KAFVLDNKLK FGDVCVFELI KGTKPILDVT IFRAAESKAM HKIDGKLAGV  600
SDSKNKTIKT EKSIPCSQPK IVHSRKLNLE KKQKGDSDGF TSKIKEEFSE DTGKHVQQSK  660
SSCKGSEVAK EMVLAYQRAK AFTSENPFFI CFMQPSYVSS ASGPMQLSIT LSRARKFFAT  720
RHSDVVLKVS SKKSWAVKCI LGTANAKLTS GWKEFVLDNN LKVGDVCVFE RVSRSKLLFN  780
VIIFTSAEGM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A2e-1519578818144B3 domain-containing transcription factor VRN
4i1k_B2e-1519578818144B3 domain-containing transcription factor VRN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1141162RKRQERNAEDVVSVDMHVKRMK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016490765.10.0PREDICTED: B3 domain-containing protein LOC_Os12g40080-like isoform X2
TrEMBLK4B4X60.0K4B4X6_SOLLC; Uncharacterized protein
STRINGSolyc02g021260.1.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.11e-32B3 family protein